285 down from 327 need a good stack tho im on Reta and Trt now. Hearing like 5 amino maybe mot c

Today is day one of a top-to-bottom revamp in Skool for info, giveaways, and more. Let's start with check-ins. I will be giving away $50 gift cards on the first Monday of every month. I'll pick one winner who checks in every Monday with their progress from the previous week, good or bad!

Retatrutide Amino Acid Sequence YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ 1 Tyrosine (Y) 2 Alanine (A) 3 Glutamic Acid (E) 4 Glycine (G) 5 Threonine (T) 6 Phenylalanine (F) 7 Isoleucine (I) 8 Serine (S) 9 Aspartic Acid (D) 10 Tyrosine (Y) 11 Serine (S) 12 Isoleucine (I) 13 Alanine (A) 14 Methionine (M) 15 Aspartic Acid (D) 16 Lysine (K) 17 Isoleucine (I) 18 Histidine (H) 19 Glutamine (Q) 20 Glutamine (Q) 21 Aspartic Acid (D) 22 Phenylalanine (F) 23 Valine (V) 24 Asparagine (N) 25 Tryptophan (W) 26 Leucine (L) 27 Leucine (L) 28 Alanine (A) 29 Glutamine (Q) 30 Lysine (K) 31 Glycine (G) 32 Lysine (K) 33 Lysine (K) 34 Asparagine (N) 35 Aspartic Acid (D) 36 Tryptophan (W) 37 Lysine (K) 38 Histidine (H) 39 Isoleucine (I) 40 Threonine (T) 41 Glutamine (Q) Triple Agonist Targets: • GLP-1 Receptor • Glp-2 Receptor •Glp-3 Receptor

Today, we're going to start digging into the bioregulators, cheat sheets, use cases, and everything. The school is going to become my primary resource over TT.

Has anyone bought raw AHK-Cu & put it in hair serum for hair growth? If so, what serum did you get? How did you add the AHK-Cu? Is the whole bottle mixed in or does it need to be measured out?