If I reconstitute GHK-Cu & also want to do SS31 on the same day, can I use the same syringe to pull the BAC or is it recommended to use one for each peptide? I’ve only reconstituted one peptide at a time in the past. So not sure about contamination with just BAC to reconstitute.

Retatrutide Amino Acid Sequence YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ 1 Tyrosine (Y) 2 Alanine (A) 3 Glutamic Acid (E) 4 Glycine (G) 5 Threonine (T) 6 Phenylalanine (F) 7 Isoleucine (I) 8 Serine (S) 9 Aspartic Acid (D) 10 Tyrosine (Y) 11 Serine (S) 12 Isoleucine (I) 13 Alanine (A) 14 Methionine (M) 15 Aspartic Acid (D) 16 Lysine (K) 17 Isoleucine (I) 18 Histidine (H) 19 Glutamine (Q) 20 Glutamine (Q) 21 Aspartic Acid (D) 22 Phenylalanine (F) 23 Valine (V) 24 Asparagine (N) 25 Tryptophan (W) 26 Leucine (L) 27 Leucine (L) 28 Alanine (A) 29 Glutamine (Q) 30 Lysine (K) 31 Glycine (G) 32 Lysine (K) 33 Lysine (K) 34 Asparagine (N) 35 Aspartic Acid (D) 36 Tryptophan (W) 37 Lysine (K) 38 Histidine (H) 39 Isoleucine (I) 40 Threonine (T) 41 Glutamine (Q) Triple Agonist Targets: • GLP-1 Receptor • Glp-2 Receptor •Glp-3 Receptor

I need 2 more order number for gift card if you ordered during the sale I'd like to get them processed today they're doing 30% off.

I know there has been research pinning higher doses recently. I'm not finding anything in here regarding this. Could someone tag me if I'm missing it??

I will get on here every day and answer any questions at 2 PM. Tag me or DM me; this will be daily.